PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015611.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 148aa    MW: 16823.2 Da    PI: 5.9569
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015611.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601025.5e-326100195
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                  aCaaCk++rrkC++ C la yfpa++  +f n++++FG+sn+ k++++++ ++r++a++++++e++++ ++P  G++gv + l +q++  ++el+
  Pbr015611.1   6 ACAACKYQRRKCNQTCELAAYFPASRFVEFVNAQHMFGMSNIEKIIATVELDQRPAAAETILFEGNIWRNNPSVGCLGVTRFLLEQVDFYEKELE 100
                  7****************************************************************************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.9865106IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-286100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MANSKACAAC KYQRRKCNQT CELAAYFPAS RFVEFVNAQH MFGMSNIEKI IATVELDQRP  60
AAAETILFEG NIWRNNPSVG CLGVTRFLLE QVDFYEKELE FPRITADMKK YEERYIYMSS  120
LKDAQEKAFD IGLMQPASFS GPGESRY*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352702.11e-106PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A067E2B94e-38A0A067E2B9_CITSI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-28LOB domain-containing protein 22